PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG497500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 243aa    MW: 27544.3 Da    PI: 9.129
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG497500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.25.2e-291059251
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +iifsstg+lye++s
  Pavir.1KG497500.1.p 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLIIFSSTGRLYEFAS 59
                         8***********************************************86 PP

2K-box77.43.8e-2677168596
                K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                           g+++++++   +q+e+a L+++++ Lq+++++l+Ge+L+ L +++Lq+Le++Le sl+++R +K++ll+++ieel +k  ++++en++L
  Pavir.1KG497500.1.p  77 LGVNNATSELMLWQREAASLRQQLHDLQESHKQLMGEELSGLGVRDLQSLENRLEMSLRSVRMRKDHLLKSEIEELHRKGSMIHQENMEL 166
                          456678888999****************************************************************************99 PP

                K-box  95 rk 96 
                           +
  Pavir.1KG497500.1.p 167 CR 168
                          76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.511161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-39160IPR002100Transcription factor, MADS-box
CDDcd002656.59E-44377No hitNo description
SuperFamilySSF554554.32E-32391IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-293859IPR002100Transcription factor, MADS-box
PfamPF014868.1E-2685169IPR002487Transcription factor, K-box
PROSITE profilePS5129715.08786179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGLIIFSS TGRLYEFAST  60
NMKAVIDRYG KAKEEQLGVN NATSELMLWQ REAASLRQQL HDLQESHKQL MGEELSGLGV  120
RDLQSLENRL EMSLRSVRMR KDHLLKSEIE ELHRKGSMIH QENMELCRRA NIMSQQKMEL  180
HRKLQASEQR DVADANTSSS TPYSFSIAHD ADAPSNLEQI QSHQKDGENH KAGAPELGLQ  240
LH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A9e-20374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-20374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-20374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D9e-20374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P1e-19174174Myocyte-specific enhancer factor 2B
1tqe_Q1e-19174174Myocyte-specific enhancer factor 2B
1tqe_R1e-19174174Myocyte-specific enhancer factor 2B
1tqe_S1e-19174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012703481.11e-159PREDICTED: MADS-box transcription factor 57-like
RefseqXP_012703484.11e-159PREDICTED: MADS-box transcription factor 57-like
SwissprotQ6Z6W21e-135MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBLA9J2381e-133A9J238_WHEAT; MIKC-type MADS-box transcription factor WM32B
STRINGLOC_Os02g49840.11e-133(Oryza sativa Japonica Group)
STRINGORGLA02G0267800.11e-133(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-88AGAMOUS-like 16